PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00405.1.p
Common NameEUGRSUZ_K00405, LOC104424530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 305aa    MW: 32457.8 Da    PI: 8.7818
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00405.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-3954114262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       k++al+cprC s+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ s
  Eucgr.K00405.1.p  54 KDQALNCPRCSSSNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRPS 114
                       6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2550106IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3355112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05958112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDNAAPSQWT AQGFLGVINN NPPMEIASSP RPVSVSLQEI KPTCGTTTTS RPHKDQALNC  60
PRCSSSNTKF CYYNNYSLSQ PRYFCKTCRR YWTEGGSLRN VPVGGGSRKN KRPSSSFSSS  120
PSSKIIKLPD LVVGPSSLPQ NPKTHEAQRD LNLTYPPDTT PTTDQQNPKS SSGIIASSSM  180
GLSLSSFMPH MPVASDSSSN FYAAGGLNFQ HLLGLKPTTS SFGSFSGHGF ESGGFLGSLQ  240
GLQESGNGDD SNDGAKLFFP VEDGLKHQVT STPRVDGQFG LQSRGQGDHS NGYWNGVLGT  300
GGSW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00405.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4497267e-41HQ449726.1 Sonneratia caseolaris microsatellite Sc_SSR_17 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035292.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLA0A058ZYQ70.0A0A058ZYQ7_EUCGR; Uncharacterized protein
STRINGGLYMA04G41170.19e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-32Dof family protein